(data stored in ACNUC1104 zone)

EMBL: CP002417.PE58

CP002417.PE58        Location/Qualifiers
FT   CDS             60814..61314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34281"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0053"
FT                   /protein_id="ADU34281.1"
FT                   /translation="MNPTTLSALAAFPAQLEAHYAAVPEAFRHWVPPSWEGVPSEAFTA
FT                   IEQLCHVRDIEIEGYHVRFRRTLSEDRPTLASIDSEPLAIERNYGAADAKQVLADFRLA
FT                   RVQTMEIVSSLTDAQLARTAVFEGYGPLTMRSLIHYLCSHDQQHLAGLQWLAGKIDAST
FT                   VPA"
     MNPTTLSALA AFPAQLEAHY AAVPEAFRHW VPPSWEGVPS EAFTAIEQLC HVRDIEIEGY        60
     HVRFRRTLSE DRPTLASIDS EPLAIERNYG AADAKQVLAD FRLARVQTME IVSSLTDAQL       120
     ARTAVFEGYG PLTMRSLIHY LCSHDQQHLA GLQWLAGKID ASTVPA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page