(data stored in ACNUC1104 zone)

EMBL: CP002417.PE6

CP002417.PE6         Location/Qualifiers
FT   CDS             7338..7856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34229"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0006"
FT                   /protein_id="ADU34229.1"
FT                   /translation="MNPMRLRRPLAALVLGGTAAFLGAVLPAHAFSNPPIQVAQGVEYM
FT                   CGGAAKGEAEFMEMVAPRWAATIELGVSDGKGAQFAGFPAKASVEIRQKYTGQTVMDVQ
FT                   TQAPYMLARLDPGAYDVNVTLGGLTLTQTLIVIAGVPGRASFLWPSNFDMASVTPPMPQ
FT                   ALAQTSAAR"
     MNPMRLRRPL AALVLGGTAA FLGAVLPAHA FSNPPIQVAQ GVEYMCGGAA KGEAEFMEMV        60
     APRWAATIEL GVSDGKGAQF AGFPAKASVE IRQKYTGQTV MDVQTQAPYM LARLDPGAYD       120
     VNVTLGGLTL TQTLIVIAGV PGRASFLWPS NFDMASVTPP MPQALAQTSA AR               172
//

If you have problems or comments...

PBIL Back to PBIL home page