(data stored in ACNUC1104 zone)

EMBL: CP002417.PE61

CP002417.PE61        Location/Qualifiers
FT   CDS             complement(62471..63082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0061"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   vap:Vapar_0057 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34284"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU0"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADU34284.1"
FT                   /translation="MCGVPAAAALAACGKRKPSTAALKSDARVLAIGDSLTFGYGASPD
FT                   ASWPVKLGEITGWQVENAGVNGDTSAGALQRLPSLLAAGSYDGILIGIGGNDMLRGVSA
FT                   SATRDNIAALVKEAREHTPHVALLATPAPDAMRAFVGSLSDAPFYEEVAKSGQALLVAN
FT                   VYSSVLSDASLRSDRIHANAQGYAKVAQLLADQFKAAGWR"
     MCGVPAAAAL AACGKRKPST AALKSDARVL AIGDSLTFGY GASPDASWPV KLGEITGWQV        60
     ENAGVNGDTS AGALQRLPSL LAAGSYDGIL IGIGGNDMLR GVSASATRDN IAALVKEARE       120
     HTPHVALLAT PAPDAMRAFV GSLSDAPFYE EVAKSGQALL VANVYSSVLS DASLRSDRIH       180
     ANAQGYAKVA QLLADQFKAA GWR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page