(data stored in ACNUC1104 zone)

EMBL: CP002417.PE62

CP002417.PE62        Location/Qualifiers
FT   CDS             complement(63180..63596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0062"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   smd:Smed_0141 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34285"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU1"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADU34285.1"
FT                   /translation="MATAQKSLCPINLALEVFGDRWSLLIVRDMMFAGKRHFREFLQSE
FT                   EGISSNILTERLGKLVEYGVLSKTDDPTHKQKAIYSLTPMGIDLLPVVTQIGIWGRKYT
FT                   PATKESGAPAAALEKGGPALQKTMRTALRRAHLS"
     MATAQKSLCP INLALEVFGD RWSLLIVRDM MFAGKRHFRE FLQSEEGISS NILTERLGKL        60
     VEYGVLSKTD DPTHKQKAIY SLTPMGIDLL PVVTQIGIWG RKYTPATKES GAPAAALEKG       120
     GPALQKTMRT ALRRAHLS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page