(data stored in ACNUC1104 zone)

EMBL: CP002417.PE63

CP002417.PE63        Location/Qualifiers
FT   CDS             63712..64302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0063"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mll1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34286"
FT                   /db_xref="GOA:E6UXU2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADU34286.1"
FT                   /translation="MRKLILQMQMSVDGYVSPANGNIDWQVWGWGDRWAWDDKLKAYFN
FT                   AVFEGVDTILLSRKIVEEGYLDHWGRAAKNYPANPQFAFAQKVVDAQKVVLTDKLEASR
FT                   WERTVIARGGMAEEVNALKREEGKDILVIGGVGFASSLVNEGLVDEFQFFVNPMAVGAG
FT                   RSVFHDQRKGHKLRLLGSVGYECGVVVNRYAPQ"
     MRKLILQMQM SVDGYVSPAN GNIDWQVWGW GDRWAWDDKL KAYFNAVFEG VDTILLSRKI        60
     VEEGYLDHWG RAAKNYPANP QFAFAQKVVD AQKVVLTDKL EASRWERTVI ARGGMAEEVN       120
     ALKREEGKDI LVIGGVGFAS SLVNEGLVDE FQFFVNPMAV GAGRSVFHDQ RKGHKLRLLG       180
     SVGYECGVVV NRYAPQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page