(data stored in ACNUC1104 zone)

EMBL: CP002417.PE64

CP002417.PE64        Location/Qualifiers
FT   CDS             64427..64870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34287"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0059"
FT                   /protein_id="ADU34287.1"
FT                   /translation="MNINSKSMAVAAAALAMCMAAGSAFAQDRRFDGRPGDDRNGRAEQ
FT                   RHDDRRGDRNFDRRGPHRDYRGNQDFRDGRQFDRRGFPQPHAEWRRGGRVPAEYRGRNY
FT                   VVNDYRAYRLQPPPRGYQWVGVGGDYVLAAIATGLIAQIIAGQ"
     MNINSKSMAV AAAALAMCMA AGSAFAQDRR FDGRPGDDRN GRAEQRHDDR RGDRNFDRRG        60
     PHRDYRGNQD FRDGRQFDRR GFPQPHAEWR RGGRVPAEYR GRNYVVNDYR AYRLQPPPRG       120
     YQWVGVGGDY VLAAIATGLI AQIIAGQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page