(data stored in SCRATCH zone)

EMBL: CP002417.PE7

CP002417.PE7         Location/Qualifiers
FT   CDS             7994..8494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34230"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0007"
FT                   /protein_id="ADU34230.1"
FT                   /translation="MTSRFSSSSSSRMRPLAAAMLCGAVLLGALSSAHAAVNPPIYMTH
FT                   GVEYMSGGIGSDEAQLMETVSPRWPATFEFAVKDHKGSADFAAGVHITVRDSSGTKLLD
FT                   NVVSGGPFMVARLEPGTYEVEARIGSQTLKQSLTVPHGASAKAIFEWPAGTDMASAGTR
FT                   TVQ"
     MTSRFSSSSS SRMRPLAAAM LCGAVLLGAL SSAHAAVNPP IYMTHGVEYM SGGIGSDEAQ        60
     LMETVSPRWP ATFEFAVKDH KGSADFAAGV HITVRDSSGT KLLDNVVSGG PFMVARLEPG       120
     TYEVEARIGS QTLKQSLTVP HGASAKAIFE WPAGTDMASA GTRTVQ                      166
//

If you have problems or comments...

PBIL Back to PBIL home page