(data stored in ACNUC1104 zone)

EMBL: CP002417.PE70

CP002417.PE70        Location/Qualifiers
FT   CDS             68261..71206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0070"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: bur:Bcep18194_B0391 hypothetical protein;
FT                   PFAM: Sel1 domain protein repeat-containing protein; SMART:
FT                   Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34293"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU9"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADU34293.1"
FT                   /translation="MGNRSWLYLEHRLSGADNGAEHQKTSADEIAEANNNFPVLWQLLL
FT                   ADGAAGDAIDDQRVFGDAGTDNLASDAHAALARIRQLHAFVEQHPMLHALPQIALQFEA
FT                   LALHLAELIDEVPADSAPRFSANLDELSWLGGETEGEGFIERNRRECNERWAEVRRCID
FT                   SGNHPGVDAALGIQRFADWEAWAWQFGFGGLSHPYFDGYEAPRDERFADFEPEEDDDED
FT                   GYERPDYDNHLGGELWRFEVDGRWGVMRLVHDEDGDGGASHRTTVVEPAWDDIRYAGGS
FT                   DPRLLWISQGERSGLLLADAEAPRVLLEPELDEVWDFEDDIATALVGDHIGLLRTDGSW
FT                   LLEPSVDEVWSFVEGRVRARVGERIGYIDLQGEWAIAPRFEEAEDFTPFGLAPARGDEG
FT                   GWGLVRADGEWAAPPDFEQLQWRHDWEAFEATRDGKSGLLDAQGRVVIEPVYEQVDLLE
FT                   EYPIEFLTSEDNDPANERNAEARPKRFAVERADGVCGLVDGRGRVLVPFDYGRFETLEP
FT                   LTGQERAHAMARRDLVRVASKGGRTAKNAPWLRGIYDVAAGRELVPCRHRTLQPLAWGT
FT                   QDIGWLVADPMPRSAKVEKGQLAVGVLRGDGTVLHPQANPWIAAAVSVADSWLVAAVRS
FT                   DLCKRWGAGEPVKAVRNDSGLYVWLHADGREQPHAEHMAARHAAGDLRAAYELACHLRD
FT                   GEGIEADPREALRWMARAAGVREPGDAPATASSDGLPVAMCELSKMLRWDTAGLGADAQ
FT                   LGRAWLLHAIAHGGADDAATQAQLGYMLCEGEGGERDLEGGVRHYELAAEKNNTMALYN
FT                   LGLAYKLGEPGEPDLARAIGYFRRGHEAGDTAATMQLGRTLCLHAGALAEQGHGEAEVN
FT                   VLHAEALYARQKVAEDSTQREQGWACYELGWMRFRGQGAPEDAAAAERWLLAGAALDDC
FT                   EENLESQRACTEVLAETFYGDPDSPLFDEDKAREWTQRLQALPATTPDAPA"
     MGNRSWLYLE HRLSGADNGA EHQKTSADEI AEANNNFPVL WQLLLADGAA GDAIDDQRVF        60
     GDAGTDNLAS DAHAALARIR QLHAFVEQHP MLHALPQIAL QFEALALHLA ELIDEVPADS       120
     APRFSANLDE LSWLGGETEG EGFIERNRRE CNERWAEVRR CIDSGNHPGV DAALGIQRFA       180
     DWEAWAWQFG FGGLSHPYFD GYEAPRDERF ADFEPEEDDD EDGYERPDYD NHLGGELWRF       240
     EVDGRWGVMR LVHDEDGDGG ASHRTTVVEP AWDDIRYAGG SDPRLLWISQ GERSGLLLAD       300
     AEAPRVLLEP ELDEVWDFED DIATALVGDH IGLLRTDGSW LLEPSVDEVW SFVEGRVRAR       360
     VGERIGYIDL QGEWAIAPRF EEAEDFTPFG LAPARGDEGG WGLVRADGEW AAPPDFEQLQ       420
     WRHDWEAFEA TRDGKSGLLD AQGRVVIEPV YEQVDLLEEY PIEFLTSEDN DPANERNAEA       480
     RPKRFAVERA DGVCGLVDGR GRVLVPFDYG RFETLEPLTG QERAHAMARR DLVRVASKGG       540
     RTAKNAPWLR GIYDVAAGRE LVPCRHRTLQ PLAWGTQDIG WLVADPMPRS AKVEKGQLAV       600
     GVLRGDGTVL HPQANPWIAA AVSVADSWLV AAVRSDLCKR WGAGEPVKAV RNDSGLYVWL       660
     HADGREQPHA EHMAARHAAG DLRAAYELAC HLRDGEGIEA DPREALRWMA RAAGVREPGD       720
     APATASSDGL PVAMCELSKM LRWDTAGLGA DAQLGRAWLL HAIAHGGADD AATQAQLGYM       780
     LCEGEGGERD LEGGVRHYEL AAEKNNTMAL YNLGLAYKLG EPGEPDLARA IGYFRRGHEA       840
     GDTAATMQLG RTLCLHAGAL AEQGHGEAEV NVLHAEALYA RQKVAEDSTQ REQGWACYEL       900
     GWMRFRGQGA PEDAAAAERW LLAGAALDDC EENLESQRAC TEVLAETFYG DPDSPLFDED       960
     KAREWTQRLQ ALPATTPDAP A                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page