(data stored in SCRATCH zone)

EMBL: CP002417.PE71

CP002417.PE71        Location/Qualifiers
FT   CDS             complement(71181..72131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0071"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: rme:Rmet_4336
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34294"
FT                   /db_xref="GOA:E6UXV0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV0"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ADU34294.1"
FT                   /translation="MTSTAPSSTAPTRAPSGTRRRHWWWHFEVPTLALAAALYGAWAAL
FT                   LWWHAALPGWALFLLGGFLAQLHSSLQHESIHAMRHLPKWLRHAVVWPPLTLWLPYPFY
FT                   NRGHSAHHVNFHLTHPERDDESAYHSAPAWAGYGPVRRWIYIANQTIAFRVVLGPFLRL
FT                   WKLARFEAGRVRAGDFSRLPTWSWHALSVAPVLYFVIGICGMGFGEYLLYVVYPGMMLG
FT                   SLRTFTEHRWADTPHERVAIVESNVVFGLLYLFNNLHHVHHRAPTMPWYEIPVYFRRHR
FT                   AEVLAANGHFYYRGYGEIVRRHLFRPVFTPVHPAW"
     MTSTAPSSTA PTRAPSGTRR RHWWWHFEVP TLALAAALYG AWAALLWWHA ALPGWALFLL        60
     GGFLAQLHSS LQHESIHAMR HLPKWLRHAV VWPPLTLWLP YPFYNRGHSA HHVNFHLTHP       120
     ERDDESAYHS APAWAGYGPV RRWIYIANQT IAFRVVLGPF LRLWKLARFE AGRVRAGDFS       180
     RLPTWSWHAL SVAPVLYFVI GICGMGFGEY LLYVVYPGMM LGSLRTFTEH RWADTPHERV       240
     AIVESNVVFG LLYLFNNLHH VHHRAPTMPW YEIPVYFRRH RAEVLAANGH FYYRGYGEIV       300
     RRHLFRPVFT PVHPAW                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page