(data stored in ACNUC1104 zone)

EMBL: CP002417.PE72

CP002417.PE72        Location/Qualifiers
FT   CDS             72267..73916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0072"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: rme:Rmet_4338 rhodanese-like protein
FT                   sulfurtransferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34295"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU34295.1"
FT                   /translation="MNSSASTTLAPVLLQALLLAEPAGELALLDVRETRWFVQRHPNLA
FT                   RNAPLSGLELQVGAFVPRRSTPVVLYDDYNAPDGPAQAAVAVLARLGYTDVRTLDGGLQ
FT                   RWVTEGLPAIDGYGTLVKAFGDLARLHYGTPSLSVDALRARRREGLPATLIDARPRAEF
FT                   EFLSLPGARNHAGTELALRRFEADDAEHVWAINCFSRTRGIIGATTLRLLGRAPDAVFV
FT                   EDGVMAWGLQGAPTVQNAVPDDELPPESPEVLRRTADELLERFALPVADAAQLASWCAD
FT                   DTRSLYIFDVRPTADPAFADTAVQQVPGGQLFMHFENLVGTRGARIVLIDDPAHRLRAA
FT                   VTSFWLTQLNQAEVYVYDGALSPEQAPPAQAVTVSDAPSPLDAEALAQLRRNGAVTVID
FT                   VGASLDYERGHLPGALYMLPASLGPLASHAVAGRTLVFTSPDGAAARRVARDAQQRWPG
FT                   SGAVFTWLRGGTEAWKASGRPLSTAFVPAQLLTPFDDDWGSVMRVFGPRRDAVWVDYLA
FT                   WERALAARVLQDPSVRFRFFPTGQVPDRAARS"
     MNSSASTTLA PVLLQALLLA EPAGELALLD VRETRWFVQR HPNLARNAPL SGLELQVGAF        60
     VPRRSTPVVL YDDYNAPDGP AQAAVAVLAR LGYTDVRTLD GGLQRWVTEG LPAIDGYGTL       120
     VKAFGDLARL HYGTPSLSVD ALRARRREGL PATLIDARPR AEFEFLSLPG ARNHAGTELA       180
     LRRFEADDAE HVWAINCFSR TRGIIGATTL RLLGRAPDAV FVEDGVMAWG LQGAPTVQNA       240
     VPDDELPPES PEVLRRTADE LLERFALPVA DAAQLASWCA DDTRSLYIFD VRPTADPAFA       300
     DTAVQQVPGG QLFMHFENLV GTRGARIVLI DDPAHRLRAA VTSFWLTQLN QAEVYVYDGA       360
     LSPEQAPPAQ AVTVSDAPSP LDAEALAQLR RNGAVTVIDV GASLDYERGH LPGALYMLPA       420
     SLGPLASHAV AGRTLVFTSP DGAAARRVAR DAQQRWPGSG AVFTWLRGGT EAWKASGRPL       480
     STAFVPAQLL TPFDDDWGSV MRVFGPRRDA VWVDYLAWER ALAARVLQDP SVRFRFFPTG       540
     QVPDRAARS                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page