(data stored in ACNUC1104 zone)

EMBL: CP002417.PE74

CP002417.PE74        Location/Qualifiers
FT   CDS             complement(74154..74969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0074"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; KEGG:
FT                   vap:Vapar_0066 septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34297"
FT                   /db_xref="GOA:E6UXV3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV3"
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /protein_id="ADU34297.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALAGKKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLSQALIKDKQCENLFVLAASQTRDKEALTQEGVEK
FT                   ILNDLAAMDFEYIVCDSPAGIETGAMMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAKEGGDPIKEHLLITRYNPNRVAGGQMLSLEDIQDILRIKLIGVIPESESVLHASN
FT                   QGVPAIHDKDTDVAQAYSDVVARFLGEEKPMRFVDAEKPGFFKRIFGGK"
     MAKIVVVTSG KGGVGKTTTS ASFASGLALA GKKTAVIDFD VGLRNLDLIM GCERRVVYDL        60
     INVIQGEANL SQALIKDKQC ENLFVLAASQ TRDKEALTQE GVEKILNDLA AMDFEYIVCD       120
     SPAGIETGAM MAMHFADEAL VVTNPEVSSV RDSDRILGML SSKTKRAKEG GDPIKEHLLI       180
     TRYNPNRVAG GQMLSLEDIQ DILRIKLIGV IPESESVLHA SNQGVPAIHD KDTDVAQAYS       240
     DVVARFLGEE KPMRFVDAEK PGFFKRIFGG K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page