(data stored in SCRATCH zone)

EMBL: CP002417.PE77

CP002417.PE77        Location/Qualifiers
FT   CDS             complement(77364..77786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0077"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   vap:Vapar_0069 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34300"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADU34300.1"
FT                   /translation="MRIWKKEISVEELTRNHVGTAVSTLGMEFLEVGDDFIRARVPVDE
FT                   RTRQPYGILHGGVSVVLAETLGSCGAHYSAPEGDRAVGLDINANHIRSVTSGWVIGTAR
FT                   PVHRGRSTQVWQIDLTNEAGELTCVSRITMAVLQPR"
     MRIWKKEISV EELTRNHVGT AVSTLGMEFL EVGDDFIRAR VPVDERTRQP YGILHGGVSV        60
     VLAETLGSCG AHYSAPEGDR AVGLDINANH IRSVTSGWVI GTARPVHRGR STQVWQIDLT       120
     NEAGELTCVS RITMAVLQPR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page