(data stored in SCRATCH zone)

EMBL: CP002417.PE78

CP002417.PE78        Location/Qualifiers
FT   CDS             77871..79214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34301"
FT                   /db_xref="GOA:E6UYX2"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0070"
FT                   /protein_id="ADU34301.1"
FT                   /translation="MKHPLRRWLLGIAAVLLLGIGALVWFVSSRLPSDEEVAVRISEGF
FT                   EKRFGVGLKVGGAHWALLPTPVLVLSDIATDQPRPVTLRRVTAQLKLTELLHRVIAVDE
FT                   LEIESLVLPRESVRAFRGKGPKPHEGGNVIALPAPWTLAPIPLEQLRWRDVVWIDRRDI
FT                   ALAYDGEVAFDPRWRPRQARIERAGATPPARLRLDREAGQDRWRTRIDVGGGTWNGVAL
FT                   FEMPAGGKLRVSAELDPRQVDIEGLVQAFGRRTSVAGKVNGHSTLVAEADEANELGALI
FT                   RSMHTRTTFSVRPATLTKVDIAKAVTTAGISRGGTTPLDELTGTLDTQGTENGIVMRYT
FT                   NLKARSGVLTASGNLQLFNRKMEGDIAVDLVDGVVGVPLKIGGSVSDPEVSLTGGALAG
FT                   AAVGSAVLPGVGTAIGARVGQQVEKLFGGGEPEKKPAPKPRKPPASQR"
     MKHPLRRWLL GIAAVLLLGI GALVWFVSSR LPSDEEVAVR ISEGFEKRFG VGLKVGGAHW        60
     ALLPTPVLVL SDIATDQPRP VTLRRVTAQL KLTELLHRVI AVDELEIESL VLPRESVRAF       120
     RGKGPKPHEG GNVIALPAPW TLAPIPLEQL RWRDVVWIDR RDIALAYDGE VAFDPRWRPR       180
     QARIERAGAT PPARLRLDRE AGQDRWRTRI DVGGGTWNGV ALFEMPAGGK LRVSAELDPR       240
     QVDIEGLVQA FGRRTSVAGK VNGHSTLVAE ADEANELGAL IRSMHTRTTF SVRPATLTKV       300
     DIAKAVTTAG ISRGGTTPLD ELTGTLDTQG TENGIVMRYT NLKARSGVLT ASGNLQLFNR       360
     KMEGDIAVDL VDGVVGVPLK IGGSVSDPEV SLTGGALAGA AVGSAVLPGV GTAIGARVGQ       420
     QVEKLFGGGE PEKKPAPKPR KPPASQR                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page