(data stored in ACNUC1104 zone)

EMBL: CP002417.PE79

CP002417.PE79        Location/Qualifiers
FT   CDS             complement(79236..81044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0079"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pna:Pnap_0164 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34302"
FT                   /db_xref="GOA:E6UYX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34302.1"
FT                   /translation="MHILWTYLRPHARLALLALLLAGISQVLALVDPIIFGKIIDRYAI
FT                   HRDGKTEQELVSGVLSLLALAVGVAIASRLAKALQEYITRLVVQKFGTQIFNDGLRQVL
FT                   RLKFPEFEDLRSGETLSMLQKVRADSERFINAFINTAFAAIVGIGFLVWYAVTKHWLLV
FT                   PVFLIGVLVLGGLTGLLSREIKSQQRSITRETNRNSGFITESLRNIELIKSLGLTFPEI
FT                   RRLQAQTTRIFALEMQKVKRIRLLSFLQGTTLSLLKLAVLFALLWLIFRDVLSTGELIA
FT                   MQFISVAIFAPLQELGNIILAYREAEASLLNFEALMQKPIERRPESPISIGPVTHLRFA
FT                   DVSFRHKGATDNALDDVSFEAGLGDTIAFVGPSGSGKSTLVKLLVGLYTPASGEVFYND
FT                   ISTRDLRYNQARRQIGFVTQETHLFAGTIRENLQLVKPDATDQEILEAMRQASCAYLAE
FT                   KSPEGLDTPIGERGMKLSGGEKQRLSIARALVREPRLLIFDEATSALDSLTEEQITATV
FT                   REISARSTQITILIAHRLSTIMHAGTIHVLEKGRIVESGTHAALVEGKGLYYAMWRQQI
FT                   GERPVPRVQEAETVAAIEPPGEAEPA"
     MHILWTYLRP HARLALLALL LAGISQVLAL VDPIIFGKII DRYAIHRDGK TEQELVSGVL        60
     SLLALAVGVA IASRLAKALQ EYITRLVVQK FGTQIFNDGL RQVLRLKFPE FEDLRSGETL       120
     SMLQKVRADS ERFINAFINT AFAAIVGIGF LVWYAVTKHW LLVPVFLIGV LVLGGLTGLL       180
     SREIKSQQRS ITRETNRNSG FITESLRNIE LIKSLGLTFP EIRRLQAQTT RIFALEMQKV       240
     KRIRLLSFLQ GTTLSLLKLA VLFALLWLIF RDVLSTGELI AMQFISVAIF APLQELGNII       300
     LAYREAEASL LNFEALMQKP IERRPESPIS IGPVTHLRFA DVSFRHKGAT DNALDDVSFE       360
     AGLGDTIAFV GPSGSGKSTL VKLLVGLYTP ASGEVFYNDI STRDLRYNQA RRQIGFVTQE       420
     THLFAGTIRE NLQLVKPDAT DQEILEAMRQ ASCAYLAEKS PEGLDTPIGE RGMKLSGGEK       480
     QRLSIARALV REPRLLIFDE ATSALDSLTE EQITATVREI SARSTQITIL IAHRLSTIMH       540
     AGTIHVLEKG RIVESGTHAA LVEGKGLYYA MWRQQIGERP VPRVQEAETV AAIEPPGEAE       600
     PA                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page