(data stored in SCRATCH zone)

EMBL: CP002417.PE8

CP002417.PE8         Location/Qualifiers
FT   CDS             8667..9875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0008"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: vap:Vapar_0008
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34231"
FT                   /db_xref="GOA:E6UXN7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU34231.1"
FT                   /translation="MPEPIAPMPIRPLSALTALLHVYIALRLVPALATLTPAWPLALVL
FT                   LAVSALTIPLPFVSRRIASNASMGEVLKWVGLISMGWFSSMFVLTLLRDAGLLLAWLAG
FT                   ALGLVQVRWNALLPWSALAVLAMATGTSLVGFLNARRTASVKRVEVPIRGLPAALEGFT
FT                   IAQLSDIHVGPTIRSAYIQRIVDAVNRLGADAIAITGDLVDGTVPELREHIAPLAGLRA
FT                   RHGTFVVTGNHEYYAGAHAWIDELRRLGLKVLLNEHVVLQTRNVRGAQTDEELFESALV
FT                   LAGVTDFTAGHFDAAHASDPHLALFDAPPLVHTRVLLAHQPRSATVAAAAGYQLQLSGH
FT                   THGGQFFPWNLFVPMQQPFTAGLHRLHDMWIYVSRGTGYWGPPKRFGAPSEITLLTLVP
FT                   ARP"
     MPEPIAPMPI RPLSALTALL HVYIALRLVP ALATLTPAWP LALVLLAVSA LTIPLPFVSR        60
     RIASNASMGE VLKWVGLISM GWFSSMFVLT LLRDAGLLLA WLAGALGLVQ VRWNALLPWS       120
     ALAVLAMATG TSLVGFLNAR RTASVKRVEV PIRGLPAALE GFTIAQLSDI HVGPTIRSAY       180
     IQRIVDAVNR LGADAIAITG DLVDGTVPEL REHIAPLAGL RARHGTFVVT GNHEYYAGAH       240
     AWIDELRRLG LKVLLNEHVV LQTRNVRGAQ TDEELFESAL VLAGVTDFTA GHFDAAHASD       300
     PHLALFDAPP LVHTRVLLAH QPRSATVAAA AGYQLQLSGH THGGQFFPWN LFVPMQQPFT       360
     AGLHRLHDMW IYVSRGTGYW GPPKRFGAPS EITLLTLVPA RP                          402
//

If you have problems or comments...

PBIL Back to PBIL home page