(data stored in ACNUC1104 zone)

EMBL: CP002417.PE80

CP002417.PE80        Location/Qualifiers
FT   CDS             81230..81388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34303"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU34303.1"
FT                   /translation="MGCLAQRNQGGGRRPGDIRFAVYPVGGIAAPNNPDKTYENALITA
FT                   GTVSTAV"
     MGCLAQRNQG GGRRPGDIRF AVYPVGGIAA PNNPDKTYEN ALITAGTVST AV                52
//

If you have problems or comments...

PBIL Back to PBIL home page