(data stored in ACNUC1104 zone)

EMBL: CP002417.PE81

CP002417.PE81        Location/Qualifiers
FT   CDS             complement(81340..82728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34304"
FT                   /db_xref="GOA:E6UYX5"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX5"
FT                   /inference="similar to AA sequence:KEGG:Daci_0285"
FT                   /protein_id="ADU34304.1"
FT                   /translation="MIEAALLNQILVATGMGLVGAIVFAAIGLVSGTDETTTLAPLTLL
FT                   VVLLGVPPEGVFTFFLAAAVAKHMTHAVPTALLGIPGDTMATPLLQDANVLRNLGVPHI
FT                   ALRKMVSGAIIAAFIAVPLAVLFAVLLAPYGAAITKAAPWIFVVAAVAIAYFSSGRWAS
FT                   VATLVPFVMVIVALQALTGKYGVKLSISYFLGIAIGPLVADLFSVISPAARARMKRDKV
FT                   RTFSLAPDVKGWTGYFPNPFKVLDRTQVKWTFATATISSATFVFSPVAMTVVLGELVGS
FT                   RIKHAYHRLTTTLAARNGVTEATYIAEALIPLIAIGLPLSPVAAGPAAPLFNAPPVFTI
FT                   DSATGQTHNLHNLLNHWEFLGYGMLAVVLAALVAYPFTMNFARRAALFVSRKVSHEAII
FT                   ATFVGLIVVISVWEGQLLGLLVILTMGLLGGLLSRAIGFNTGVQFMGYYTAVLTVPAVI
FT                   KAFS"
     MIEAALLNQI LVATGMGLVG AIVFAAIGLV SGTDETTTLA PLTLLVVLLG VPPEGVFTFF        60
     LAAAVAKHMT HAVPTALLGI PGDTMATPLL QDANVLRNLG VPHIALRKMV SGAIIAAFIA       120
     VPLAVLFAVL LAPYGAAITK AAPWIFVVAA VAIAYFSSGR WASVATLVPF VMVIVALQAL       180
     TGKYGVKLSI SYFLGIAIGP LVADLFSVIS PAARARMKRD KVRTFSLAPD VKGWTGYFPN       240
     PFKVLDRTQV KWTFATATIS SATFVFSPVA MTVVLGELVG SRIKHAYHRL TTTLAARNGV       300
     TEATYIAEAL IPLIAIGLPL SPVAAGPAAP LFNAPPVFTI DSATGQTHNL HNLLNHWEFL       360
     GYGMLAVVLA ALVAYPFTMN FARRAALFVS RKVSHEAIIA TFVGLIVVIS VWEGQLLGLL       420
     VILTMGLLGG LLSRAIGFNT GVQFMGYYTA VLTVPAVIKA FS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page