(data stored in ACNUC1104 zone)

EMBL: CP002417.PE83

CP002417.PE83        Location/Qualifiers
FT   CDS             complement(83272..84558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0083"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="KEGG: dac:Daci_0287 hydroxymethylglutaryl-CoA
FT                   reductase, degradative; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34306"
FT                   /db_xref="GOA:E6UYX7"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX7"
FT                   /inference="protein motif:TFAM:TIGR00532"
FT                   /protein_id="ADU34306.1"
FT                   /translation="MVADSRIPNFRALTPAQRFAHIAKAASLTDDEVALLAQPGALSVD
FT                   RANGMVENVIGTFELPLGVAGNFTVNGRDYLVPMAVEEPSVVAAASFMAKLAREGGGFE
FT                   ASSTGPLMRAQVQVIGITDPYGARLALLRAREEILAVANSRDKVLIDLGGGCRDIEVHV
FT                   FGDTPRGAMVVMHLIVDVRDAMGANTVNTMAEAVSPLVEKLTGGTVRLRILSNLADLRL
FT                   ARARVRLAPAVLATRERSGEEVVEGVIDAYTFAAIDPYRAATHNKGIMNGVDPVIVATG
FT                   NDWRAVEAGAHAYACRSGRYTSLTTWEKDTTGALVGTIEMPMPVGLVGGATKTHPLARL
FT                   ALKILDVKSAQELGEVAVAVGLAQNLGALRALATEGIQRGHMALHARNIALVAGATGDE
FT                   IDSIAKQMAAEHDVRTDRAVALLEALRKK"
     MVADSRIPNF RALTPAQRFA HIAKAASLTD DEVALLAQPG ALSVDRANGM VENVIGTFEL        60
     PLGVAGNFTV NGRDYLVPMA VEEPSVVAAA SFMAKLAREG GGFEASSTGP LMRAQVQVIG       120
     ITDPYGARLA LLRAREEILA VANSRDKVLI DLGGGCRDIE VHVFGDTPRG AMVVMHLIVD       180
     VRDAMGANTV NTMAEAVSPL VEKLTGGTVR LRILSNLADL RLARARVRLA PAVLATRERS       240
     GEEVVEGVID AYTFAAIDPY RAATHNKGIM NGVDPVIVAT GNDWRAVEAG AHAYACRSGR       300
     YTSLTTWEKD TTGALVGTIE MPMPVGLVGG ATKTHPLARL ALKILDVKSA QELGEVAVAV       360
     GLAQNLGALR ALATEGIQRG HMALHARNIA LVAGATGDEI DSIAKQMAAE HDVRTDRAVA       420
     LLEALRKK                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page