(data stored in ACNUC1104 zone)

EMBL: CP002417.PE84

CP002417.PE84        Location/Qualifiers
FT   CDS             84696..86081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0084"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="KEGG: dac:Daci_0288 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; aminotransferase class I and
FT                   II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34307"
FT                   /db_xref="GOA:E6UYX8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX8"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU34307.1"
FT                   /translation="MTTIADSLADTLARQIASGAYKAGDKLPSLRELAQLHGYAKNTVV
FT                   AAFELLVSRGLVEPRRGSGYFVLAQSTTPKPPEEDAGSLGRAMDIVWLMREQLKTQPDA
FT                   VAVGDGFPPVEWLADVRLDKYHPKVVRTGLGALFRYGSRFGYAPLRDHLVRKLADFGIG
FT                   AEPRQIVLTHGANEAMDIVIRYFVPPGGKVLVDDPGYYPLFGKLKLAGAQMLAVPRLAD
FT                   GPDLDVLEQLLIAERPRLFFTQSLAHNPTGSDISPAKAFRVLQLAQKYDLLIVENDPLA
FT                   DFKPTALPRLSALDQLERTIYIGSFSKSFSAALRVGFIACGADLASDLADLKALIHVSS
FT                   SEYSERTVDVILSEGHYQRHLNRLQNRLGEATRSALQLFDSVDTEVFARTPQSLYIWAA
FT                   LPGVADSLAFAKELLPRKIVMAPGRIFSVDSTQVSRWSRFNVGAMADPRFAKALRTALR
FT                   RRV"
     MTTIADSLAD TLARQIASGA YKAGDKLPSL RELAQLHGYA KNTVVAAFEL LVSRGLVEPR        60
     RGSGYFVLAQ STTPKPPEED AGSLGRAMDI VWLMREQLKT QPDAVAVGDG FPPVEWLADV       120
     RLDKYHPKVV RTGLGALFRY GSRFGYAPLR DHLVRKLADF GIGAEPRQIV LTHGANEAMD       180
     IVIRYFVPPG GKVLVDDPGY YPLFGKLKLA GAQMLAVPRL ADGPDLDVLE QLLIAERPRL       240
     FFTQSLAHNP TGSDISPAKA FRVLQLAQKY DLLIVENDPL ADFKPTALPR LSALDQLERT       300
     IYIGSFSKSF SAALRVGFIA CGADLASDLA DLKALIHVSS SEYSERTVDV ILSEGHYQRH       360
     LNRLQNRLGE ATRSALQLFD SVDTEVFART PQSLYIWAAL PGVADSLAFA KELLPRKIVM       420
     APGRIFSVDS TQVSRWSRFN VGAMADPRFA KALRTALRRR V                           461
//

If you have problems or comments...

PBIL Back to PBIL home page