(data stored in SCRATCH zone)

EMBL: CP002417.PE87

CP002417.PE87        Location/Qualifiers
FT   CDS             complement(87908..89716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0088"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vap:Vapar_0071 feruloyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34310"
FT                   /db_xref="GOA:E6UYY1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU34310.1"
FT                   /translation="MTDFLHDESLIAPPRTVRIDFDDGSFALRSPQTLKPYARCIGEWI
FT                   ERWARETPDALAFAERDESGEGWRKLDYRALRHAVGSVAQGLLDLKLPAGQPIVILSDN
FT                   AIDHAVLMLATMHIGRTACSLSSAYSRMAKDPSRLHGMLKALGPSLIYASDAKVYGGAL
FT                   AGCGVEAVTVFSRNADTHPGAMSFDQLLAAKETPAVMDAFAAILADTHAKYLLTSGSTG
FT                   KPKVVINTHRMLCANQQMMAQTWRFLVEEKPVLVDWLPWSHTFGANHNLHMVLCHGGAL
FT                   YIDEGRPAPGLIEKTVRNLREVKPTLLFNVPRGFDMLLPFLEADDALATEVFSRLRLAF
FT                   YAAAALAPSTWQRLEAVAQRVRPTRPLWLTTSWGATETSPAITSAHWKLDGAGCIGAPL
FT                   PGLELKFVPNGQKLEMRVKGVSVFPGYRDAPRETAEAFDEEGYYRIGDAGFLANAAEPA
FT                   HGVIFNGRVAEDFKLSTGTWVSVGTLRVKLVSMLAPHVQDVVLTGHDLDEIGMLVFASP
FT                   QAASLSPEALAERIAGVLRALRDEGAGSSQCPACALVLAEPPSLDAGEITDKGYINQRA
FT                   VLARRAADVARLHAADPDPQVVRLRG"
     MTDFLHDESL IAPPRTVRID FDDGSFALRS PQTLKPYARC IGEWIERWAR ETPDALAFAE        60
     RDESGEGWRK LDYRALRHAV GSVAQGLLDL KLPAGQPIVI LSDNAIDHAV LMLATMHIGR       120
     TACSLSSAYS RMAKDPSRLH GMLKALGPSL IYASDAKVYG GALAGCGVEA VTVFSRNADT       180
     HPGAMSFDQL LAAKETPAVM DAFAAILADT HAKYLLTSGS TGKPKVVINT HRMLCANQQM       240
     MAQTWRFLVE EKPVLVDWLP WSHTFGANHN LHMVLCHGGA LYIDEGRPAP GLIEKTVRNL       300
     REVKPTLLFN VPRGFDMLLP FLEADDALAT EVFSRLRLAF YAAAALAPST WQRLEAVAQR       360
     VRPTRPLWLT TSWGATETSP AITSAHWKLD GAGCIGAPLP GLELKFVPNG QKLEMRVKGV       420
     SVFPGYRDAP RETAEAFDEE GYYRIGDAGF LANAAEPAHG VIFNGRVAED FKLSTGTWVS       480
     VGTLRVKLVS MLAPHVQDVV LTGHDLDEIG MLVFASPQAA SLSPEALAER IAGVLRALRD       540
     EGAGSSQCPA CALVLAEPPS LDAGEITDKG YINQRAVLAR RAADVARLHA ADPDPQVVRL       600
     RG                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page