(data stored in ACNUC1104 zone)

EMBL: CP002417.PE88

CP002417.PE88        Location/Qualifiers
FT   CDS             complement(89718..90704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0089"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: vap:Vapar_0072 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34311"
FT                   /db_xref="GOA:E6UYY2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADU34311.1"
FT                   /translation="MDDEGREPLRAVEIMTHLNVQRVAVVGTGVIGASWTAYFLAQGLD
FT                   VNATDPSPGAEDRLRAAVAQHWPTLERFGLAEGASVDRLRFHDSLEDAVSVADFVQENG
FT                   PERMDFKIDLFRRMDAAAPPETILASSSSGLAISGVQSGCAHPQRVVLGHPFNPPHLIP
FT                   LVEVIGGEKTSADTIERTMAFYAAIGKRPIHVKREVKGHIANRLQAALWREAFHLVNEG
FT                   VASVADIDTAIAHGPGLRWAVMGPFMNLHLSGGAGGIEHVLAHLGGPIEDWWKDLGAPS
FT                   MTAELKQKVAAGVAEELGARRTSDLEAARDTLLLNLIRAKADTGKLD"
     MDDEGREPLR AVEIMTHLNV QRVAVVGTGV IGASWTAYFL AQGLDVNATD PSPGAEDRLR        60
     AAVAQHWPTL ERFGLAEGAS VDRLRFHDSL EDAVSVADFV QENGPERMDF KIDLFRRMDA       120
     AAPPETILAS SSSGLAISGV QSGCAHPQRV VLGHPFNPPH LIPLVEVIGG EKTSADTIER       180
     TMAFYAAIGK RPIHVKREVK GHIANRLQAA LWREAFHLVN EGVASVADID TAIAHGPGLR       240
     WAVMGPFMNL HLSGGAGGIE HVLAHLGGPI EDWWKDLGAP SMTAELKQKV AAGVAEELGA       300
     RRTSDLEAAR DTLLLNLIRA KADTGKLD                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page