(data stored in SCRATCH zone)

EMBL: CP002417.PE9

CP002417.PE9         Location/Qualifiers
FT   CDS             complement(9894..10391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34232"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0009"
FT                   /protein_id="ADU34232.1"
FT                   /translation="MSSLSSTARLANPLMQWLDLALKTNEMLLSSGSVIRMRTERIAKA
FT                   GLTPSAADLAEFQLMGHEKLAAASESGMAMVKQWHSSHFSLANKALQQWLQGTTAFFSM
FT                   AGSVTPAQAAARGDAFVQTAARTANAASQLSGVAVRIAREGLKPIHAAATSNARRLAEL
FT                   QS"
     MSSLSSTARL ANPLMQWLDL ALKTNEMLLS SGSVIRMRTE RIAKAGLTPS AADLAEFQLM        60
     GHEKLAAASE SGMAMVKQWH SSHFSLANKA LQQWLQGTTA FFSMAGSVTP AQAAARGDAF       120
     VQTAARTANA ASQLSGVAVR IAREGLKPIH AAATSNARRL AELQS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page