(data stored in ACNUC1104 zone)

EMBL: CP002417.PE90

CP002417.PE90        Location/Qualifiers
FT   CDS             complement(91928..92851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0091"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   vap:Vapar_0074 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34313"
FT                   /db_xref="GOA:E6UYY4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY4"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADU34313.1"
FT                   /translation="MSSKRKVIVTIAPTGGMAHKSQNPHLPTQPAEIAADVLRCWNAGA
FT                   SVVAIHARRPDDGATCNAEVYRDINSRIRAGGCDIVINNSTGGGVHGDMVKPLAGDRWE
FT                   IAWEERIKGMDAGAEMCTLDATTLNLSFEGKQILMDTPITKGRELAAGMKARGIKPEWE
FT                   VFSPTHILQDTTTLIGEGHDGEPYFINLVMNVHRNFQNAMPYSPRFLQMMVDTLPKGSI
FT                   FCVSGIGPSQLEANVAALLLGGHARVGLEDNLYFRQGELATNVQLTERIVRVIRELDME
FT                   VATPAEARQMMGLPRTGTPRPEFAMG"
     MSSKRKVIVT IAPTGGMAHK SQNPHLPTQP AEIAADVLRC WNAGASVVAI HARRPDDGAT        60
     CNAEVYRDIN SRIRAGGCDI VINNSTGGGV HGDMVKPLAG DRWEIAWEER IKGMDAGAEM       120
     CTLDATTLNL SFEGKQILMD TPITKGRELA AGMKARGIKP EWEVFSPTHI LQDTTTLIGE       180
     GHDGEPYFIN LVMNVHRNFQ NAMPYSPRFL QMMVDTLPKG SIFCVSGIGP SQLEANVAAL       240
     LLGGHARVGL EDNLYFRQGE LATNVQLTER IVRVIRELDM EVATPAEARQ MMGLPRTGTP       300
     RPEFAMG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page