(data stored in SCRATCH zone)

EMBL: CP002417.PE91

CP002417.PE91        Location/Qualifiers
FT   CDS             92976..93689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0092"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: vap:Vapar_0075 putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: cyclic nucleotide-binding;
FT                   SMART: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34314"
FT                   /db_xref="GOA:E6UYY5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU34314.1"
FT                   /translation="MATKKAEPPITAASLTIPQLLQGSAWFPLLDATARDRVLDEMREV
FT                   EVAAGAALCRRGDTPLHWYGTLEGLLKWSITSSDGRSVTFGGLSVGSWFGEGTLLRAVP
FT                   RSADIIALRPSRVAQLPLETFEWLHRTQRGFDHFLLQQINERLHWFMGNYAAHRLLDAD
FT                   SQVARALAGLFHPWLHPGSEPYLQTSQEEIANLSGVSRQRCNAALNRLKEAGFLRIEYG
FT                   GITVIDLDGLRRFIE"
     MATKKAEPPI TAASLTIPQL LQGSAWFPLL DATARDRVLD EMREVEVAAG AALCRRGDTP        60
     LHWYGTLEGL LKWSITSSDG RSVTFGGLSV GSWFGEGTLL RAVPRSADII ALRPSRVAQL       120
     PLETFEWLHR TQRGFDHFLL QQINERLHWF MGNYAAHRLL DADSQVARAL AGLFHPWLHP       180
     GSEPYLQTSQ EEIANLSGVS RQRCNAALNR LKEAGFLRIE YGGITVIDLD GLRRFIE          237
//

If you have problems or comments...

PBIL Back to PBIL home page