(data stored in ACNUC1104 zone)

EMBL: CP002417.PE94

CP002417.PE94        Location/Qualifiers
FT   CDS             94825..95736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0080 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34317"
FT                   /db_xref="GOA:E6UYY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34317.1"
FT                   /translation="MQRQFGDILLGSIELFCLAAETGGFTSAALAAGVTPAAVSRSISR
FT                   LEKRLGLRLFVRTTRSVRLTDAGRSYFAQCRQALAQLAEAEREVMGQQAQPSGTLRISV
FT                   PTTYGHHRILPMLPAFRERYPDIRLHVHLSNRNIDFVEEGYDMAVRVRAQPDSTLIARH
FT                   LEDAALVVVATRKYLKAAGTPRTPDDLAAHECIQFELPSSGRRISWLFKEEGQDREVLA
FT                   DSAYSCSDDVLGGVTLAKSGAGLFQTYRFVVQKELADGSLVEVLKPFAGRSRPYTLLYP
FT                   DGRHAPLRMRVFIDFLMAQRAA"
     MQRQFGDILL GSIELFCLAA ETGGFTSAAL AAGVTPAAVS RSISRLEKRL GLRLFVRTTR        60
     SVRLTDAGRS YFAQCRQALA QLAEAEREVM GQQAQPSGTL RISVPTTYGH HRILPMLPAF       120
     RERYPDIRLH VHLSNRNIDF VEEGYDMAVR VRAQPDSTLI ARHLEDAALV VVATRKYLKA       180
     AGTPRTPDDL AAHECIQFEL PSSGRRISWL FKEEGQDREV LADSAYSCSD DVLGGVTLAK       240
     SGAGLFQTYR FVVQKELADG SLVEVLKPFA GRSRPYTLLY PDGRHAPLRM RVFIDFLMAQ       300
     RAA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page