(data stored in ACNUC1104 zone)

EMBL: CP002417.PE96

CP002417.PE96        Location/Qualifiers
FT   CDS             complement(96599..97345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0097"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0084 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34319"
FT                   /db_xref="GOA:E6UYZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34319.1"
FT                   /translation="MNALLSVEGLTRRFGGLTAVNAVTLDLHVGEVHAVIGTNGAGKST
FT                   LINMLSGEIEASEGRIALDGIDITQRAQSRRARDGVGRSYQRTTIFPEFSVHENCRLAA
FT                   QAATARPWAIWQASQRCAASNAAADSALEAAGLSNESLRIAGALSHGAQRQLEVAMCLA
FT                   TNPRVLLLDEPLAGMGAEETDRMLTLLARLKATHAILLVEHDMDAVFRIADRITVMVNG
FT                   TVIATGDPTSIRENPEVRTAYLGEDH"
     MNALLSVEGL TRRFGGLTAV NAVTLDLHVG EVHAVIGTNG AGKSTLINML SGEIEASEGR        60
     IALDGIDITQ RAQSRRARDG VGRSYQRTTI FPEFSVHENC RLAAQAATAR PWAIWQASQR       120
     CAASNAAADS ALEAAGLSNE SLRIAGALSH GAQRQLEVAM CLATNPRVLL LDEPLAGMGA       180
     EETDRMLTLL ARLKATHAIL LVEHDMDAVF RIADRITVMV NGTVIATGDP TSIRENPEVR       240
     TAYLGEDH                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page