(data stored in SCRATCH zone)

EMBL: CP002417.PE97

CP002417.PE97        Location/Qualifiers
FT   CDS             complement(97470..98423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0098"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0085 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34320"
FT                   /db_xref="GOA:E6UYZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34320.1"
FT                   /translation="MMKKGAFLVPLACALLIGIAGPLMGNYASDFVVKVMILSIFALSL
FT                   ELLVGMTGLVSLGHAAFYGIGAYVTVLASGSEGGNFALLLPMAVGAAALYALFVGALSL
FT                   RTRGVYFIMVTLAFAQMAFFVFHDTKVGGGSDGIYMYVRPAIGALDLENRTVLFYVVLA
FT                   SLVFTYGLLALIRRSRFGAALAGIRVNEQRMRAAGFPVYGYKLAAFVLAGALAGLAGFL
FT                   LASRDGVVNPELMAWHNSGEVLLMVILGGLGHLRGAVIGAIAFTLLKEIFSTHAVMGPL
FT                   ADHWQLTLGIAIIVFVAWLPKGLIGLVNRISPKEAA"
     MMKKGAFLVP LACALLIGIA GPLMGNYASD FVVKVMILSI FALSLELLVG MTGLVSLGHA        60
     AFYGIGAYVT VLASGSEGGN FALLLPMAVG AAALYALFVG ALSLRTRGVY FIMVTLAFAQ       120
     MAFFVFHDTK VGGGSDGIYM YVRPAIGALD LENRTVLFYV VLASLVFTYG LLALIRRSRF       180
     GAALAGIRVN EQRMRAAGFP VYGYKLAAFV LAGALAGLAG FLLASRDGVV NPELMAWHNS       240
     GEVLLMVILG GLGHLRGAVI GAIAFTLLKE IFSTHAVMGP LADHWQLTLG IAIIVFVAWL       300
     PKGLIGLVNR ISPKEAA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page