(data stored in ACNUC1104 zone)

EMBL: CP002417.PE99

CP002417.PE99        Location/Qualifiers
FT   CDS             complement(99487..100662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0100"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0087 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34322"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34322.1"
FT                   /translation="MTTIRTARLALTAIAFAALASAAGAQGTGKLKVGLMLPYSGTYTA
FT                   LGVAIENGFKLYVDEQGGKLSGREIEYFKVDDESDPAKATDNVNKLIKRDNVDVIVGTV
FT                   HSGVAMAMAKAAKESGTVLIVPNAGADAVTGPMCAPNIFRSSFSNWQPAFAMGEVAAKQ
FT                   QGKKKAMTITWKYAAGDESVNGFKEGFEKNGGKVDKQLTLPFPNVEFQALLTEIAAAKP
FT                   DAVYAFFAGGGAVKFVKDYQAAGLNKTIPLYGPGFLTDGTLDAQGDSAQGMLTTLHYAD
FT                   GLNTARDNAFRVAYAKSFKLQPDVYAVQGYDAAQMLGVGLAATKGDISKKAEFTGAIEK
FT                   AKIDSPRGTFTMSKSHNPVQDIYLRKVDGKENKLVSTAIKGLADPARGCRM"
     MTTIRTARLA LTAIAFAALA SAAGAQGTGK LKVGLMLPYS GTYTALGVAI ENGFKLYVDE        60
     QGGKLSGREI EYFKVDDESD PAKATDNVNK LIKRDNVDVI VGTVHSGVAM AMAKAAKESG       120
     TVLIVPNAGA DAVTGPMCAP NIFRSSFSNW QPAFAMGEVA AKQQGKKKAM TITWKYAAGD       180
     ESVNGFKEGF EKNGGKVDKQ LTLPFPNVEF QALLTEIAAA KPDAVYAFFA GGGAVKFVKD       240
     YQAAGLNKTI PLYGPGFLTD GTLDAQGDSA QGMLTTLHYA DGLNTARDNA FRVAYAKSFK       300
     LQPDVYAVQG YDAAQMLGVG LAATKGDISK KAEFTGAIEK AKIDSPRGTF TMSKSHNPVQ       360
     DIYLRKVDGK ENKLVSTAIK GLADPARGCR M                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page