(data stored in SCRATCH zone)

EMBL: CP002505.PE102

CP002505.PE102       Location/Qualifiers
FT   CDS             complement(108390..108869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddd:Dda3937_01993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71735"
FT                   /db_xref="InterPro:IPR022798"
FT                   /db_xref="InterPro:IPR038470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3N0"
FT                   /inference="similar to AA sequence:KEGG:Dda3937_01993"
FT                   /protein_id="ADW71735.1"
FT                   /translation="MQEHNYTQVAQEYYRQRHTTPGWQSLVQVLFSGILASADDEDGRR
FT                   FLTLMGNNLARQHPLPASATLGELEDNINHILSRFDWGVVKLEATSQQLALVHIAWPAS
FT                   PQGQDDALWPIALIALFEGLYAEWLLSQGGQPYVPLRWQESTPEGAFVFRYQNGL"
     MQEHNYTQVA QEYYRQRHTT PGWQSLVQVL FSGILASADD EDGRRFLTLM GNNLARQHPL        60
     PASATLGELE DNINHILSRF DWGVVKLEAT SQQLALVHIA WPASPQGQDD ALWPIALIAL       120
     FEGLYAEWLL SQGGQPYVPL RWQESTPEGA FVFRYQNGL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page