(data stored in SCRATCH zone)

EMBL: CP002505.PE117

CP002505.PE117       Location/Qualifiers
FT   CDS             complement(132380..133504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0118"
FT                   /product="ribonuclease"
FT                   /note="KEGG: spe:Spro_4744 putative ribonuclease; TIGRFAM:
FT                   ribonuclease; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71750"
FT                   /db_xref="GOA:A0A0H3F3P2"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3P2"
FT                   /inference="protein motif:TFAM:TIGR00766"
FT                   /protein_id="ADW71750.1"
FT                   /translation="MPIISKQEPATQEKPTPLINIKTGNQTVDKNIGRFSRLVEYVQSW
FT                   GWVAHLLRATERFNDRLGSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLAELI
FT                   NRIVNSISDPNLANTLKSTVNTAIQQRTAVGLSGLLIALYSGVSWMGNLREAIRAQSRD
FT                   VWERNPQDQEKIYRRYIRDFISLTGLVLALIITLSLTSIAGAAQKTIVDALGLGGIDWL
FT                   RPVMTSITLVISIAANYLLFLWIFWMLPRHKPRKKALLRGTLLAAMGFEVIKFVMTMTL
FT                   PKLATSPSGAAFGSVIGLMAFFYFFARLTLFVAAWIATAKYKDDPPMPDPKQKAAKHAK
FT                   NATENDSEYTPDNLIVPDEMHISTVNAEDEVKKQ"
     MPIISKQEPA TQEKPTPLIN IKTGNQTVDK NIGRFSRLVE YVQSWGWVAH LLRATERFND        60
     RLGSQFGAAI TYFSFLSLIP ILMVSFAAVG FVLASNPDLL AELINRIVNS ISDPNLANTL       120
     KSTVNTAIQQ RTAVGLSGLL IALYSGVSWM GNLREAIRAQ SRDVWERNPQ DQEKIYRRYI       180
     RDFISLTGLV LALIITLSLT SIAGAAQKTI VDALGLGGID WLRPVMTSIT LVISIAANYL       240
     LFLWIFWMLP RHKPRKKALL RGTLLAAMGF EVIKFVMTMT LPKLATSPSG AAFGSVIGLM       300
     AFFYFFARLT LFVAAWIATA KYKDDPPMPD PKQKAAKHAK NATENDSEYT PDNLIVPDEM       360
     HISTVNAEDE VKKQ                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page