(data stored in SCRATCH zone)

EMBL: CP002505.PE118

CP002505.PE118       Location/Qualifiers
FT   CDS             complement(133589..134530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ebi:EbC_01350 O-succinylbenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71751"
FT                   /db_xref="GOA:A0A0H3F9G1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9G1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADW71751.1"
FT                   /translation="MIFTVSFSTTIRQIVDKIQSMQVFVRVAELSNFTRAAESLGLPKG
FT                   SVSRLVQQLETRMSARLLHRSTRRVQLTQDGQVFYQRCKELLASMDELESMFQSNPASV
FT                   SGRLRVDMTTGMATHLVLPRLAEFLNRYPALEIELSCTDHRVDVVREGFDCVIRSGTLK
FT                   DSGLIARPLGHLSMVNCASPGYLRRYGTPDHPDQLAQHAMVHYEQILGSHTSAFEYLDG
FT                   KQVKTVKSGGAVTVNSTETYVSACINGLGIIQVPLIGVRDALAGGQLVSILPQFRAPPM
FT                   PVTLVYPHRLNLSRRVKVFMDWLTDITQTFIA"
     MIFTVSFSTT IRQIVDKIQS MQVFVRVAEL SNFTRAAESL GLPKGSVSRL VQQLETRMSA        60
     RLLHRSTRRV QLTQDGQVFY QRCKELLASM DELESMFQSN PASVSGRLRV DMTTGMATHL       120
     VLPRLAEFLN RYPALEIELS CTDHRVDVVR EGFDCVIRSG TLKDSGLIAR PLGHLSMVNC       180
     ASPGYLRRYG TPDHPDQLAQ HAMVHYEQIL GSHTSAFEYL DGKQVKTVKS GGAVTVNSTE       240
     TYVSACINGL GIIQVPLIGV RDALAGGQLV SILPQFRAPP MPVTLVYPHR LNLSRRVKVF       300
     MDWLTDITQT FIA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page