(data stored in SCRATCH zone)

EMBL: CP002505.PE121

CP002505.PE121       Location/Qualifiers
FT   CDS             136455..137033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0122"
FT                   /product="cytochrome B561"
FT                   /note="KEGG: pam:PANA_1606 YceJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71754"
FT                   /db_xref="GOA:A0A0H3F756"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F756"
FT                   /inference="similar to AA sequence:KEGG:PANA_1606"
FT                   /protein_id="ADW71754.1"
FT                   /translation="MQTSSSVLRSRYDGLTILLHWLTALAVIFLFASAHIWEVLERGTP
FT                   LRKGLQSVHISVGILLAAIIIGRLLWRLFTVSTGRSKQQPVAMPTLMKAAAHLTHLALY
FT                   LLLVAQIILGFLFRWSQAEPFYFFGLFPIPDVFNFDSVMTRTFGSLHNNVAWALIIIAG
FT                   IHALAALFHHYVLRDGILRRMLPGSTSRP"
     MQTSSSVLRS RYDGLTILLH WLTALAVIFL FASAHIWEVL ERGTPLRKGL QSVHISVGIL        60
     LAAIIIGRLL WRLFTVSTGR SKQQPVAMPT LMKAAAHLTH LALYLLLVAQ IILGFLFRWS       120
     QAEPFYFFGL FPIPDVFNFD SVMTRTFGSL HNNVAWALII IAGIHALAAL FHHYVLRDGI       180
     LRRMLPGSTS RP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page