(data stored in SCRATCH zone)

EMBL: CP002505.PE132

CP002505.PE132       Location/Qualifiers
FT   CDS             complement(150321..150773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0135"
FT                   /product="Conserved hypothetical protein CHP00022"
FT                   /note="PFAM: Conserved hypothetical protein CHP00022; KEGG:
FT                   spe:Spro_1974 cryptic beta-D-galactosidase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71765"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Q5"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ADW71765.1"
FT                   /translation="MIILDCLTEFQRLYRSGKKWQRCMEAINNLDNIRPGVFHSVGDSL
FT                   VYRLASGSEKQRAEFEGHRRYFDVHYYLEGAEEIEFSAKSALHRVSPYDDETDREFFTG
FT                   QGETIKVPKGRVIIFENHEAYRFRPEKDVRKVILKVTVEESYFVNK"
     MIILDCLTEF QRLYRSGKKW QRCMEAINNL DNIRPGVFHS VGDSLVYRLA SGSEKQRAEF        60
     EGHRRYFDVH YYLEGAEEIE FSAKSALHRV SPYDDETDRE FFTGQGETIK VPKGRVIIFE       120
     NHEAYRFRPE KDVRKVILKV TVEESYFVNK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page