(data stored in SCRATCH zone)

EMBL: CP002505.PE156

CP002505.PE156       Location/Qualifiers
FT   CDS             complement(178133..178729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0159"
FT                   /product="glucokinase"
FT                   /note="KEGG: ebi:EbC_37880 glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71789"
FT                   /db_xref="GOA:A0A0H3F781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F781"
FT                   /inference="similar to AA sequence:KEGG:EbC_37880"
FT                   /protein_id="ADW71789.1"
FT                   /translation="MSENRNASRNGSTGKRVILVNGIPASGKSRLAVELSAYSGWLQLS
FT                   LDGIKNPFLQRLENVDRPFNRVLGLASYQVIWDIIGGAPEGSTFIVDAWFGFQPKEVLQ
FT                   DYLQRAGISQVVEIWCQIDAELAAERFSSRLGERLPGHVGAEYIPELKILAGKARPITP
FT                   GPVYSVDQNVIGQNKPVNIVDIHAWIINSFNTQIQ"
     MSENRNASRN GSTGKRVILV NGIPASGKSR LAVELSAYSG WLQLSLDGIK NPFLQRLENV        60
     DRPFNRVLGL ASYQVIWDII GGAPEGSTFI VDAWFGFQPK EVLQDYLQRA GISQVVEIWC       120
     QIDAELAAER FSSRLGERLP GHVGAEYIPE LKILAGKARP ITPGPVYSVD QNVIGQNKPV       180
     NIVDIHAWII NSFNTQIQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page