(data stored in SCRATCH zone)

EMBL: CP002505.PE160

CP002505.PE160       Location/Qualifiers
FT   CDS             181743..184658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0163"
FT                   /product="FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ent:Ent638_0982 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71793"
FT                   /db_xref="GOA:A0A0H3F4H9"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H9"
FT                   /inference="protein motif:PFAM:PF01346"
FT                   /protein_id="ADW71793.1"
FT                   /translation="MMARVKSFFLILLLINIQGAHAEEPVDANLGLLDQLQSENLISAP
FT                   EPSVFAEKDKTSSPLIQPPKNIVVPKALVEKPVAQKPRPKPTPAPVRKAPKALQPASTQ
FT                   SAPAVPATANVSDTQKKANEQLKKSLETAKSTAEKSRDQYAALQKSYADTQKENQQLQT
FT                   QIAALKAKPVVIPPSADQKLAQKKTQDELKKLQNSLKNTQQENQQITTQLQKLKSSQKH
FT                   AESLTEKLSVAQTATKKYQDEVADIQQSLKKTMGENARLKAQLTAFKTSQDGSVKKSSE
FT                   QVAASQLATKKAQKEFAALEASFKKLSSENTQLKTQLDTVKKQSSARIEQLVSSEHANG
FT                   KSLAEFAVLNATLQQATEENHKLKTQFETLQKQSTAQADKLQALQSTGNKSQANVVELQ
FT                   TTAKQAAAENVQLKTQLASLQKQGASQNEKIAFAVEANNKSLNENQLLQKSLKQATDEN
FT                   AQLKSQLADLQKQDAVRNDKLSVSDAVNKKSQADYVALQKTLKQATDENAGLKNQLAAS
FT                   QKETAAQTGKLSVSETAVKKSQADYVALQKILKQAADENVQMKTQLADLQKQGTAQNGK
FT                   LSVYEATIKKSQADYLVLQKSVKQAADENAQMKTQLAELQKQGAAQNEKLSVSQAANKK
FT                   SQADYLALQKTLKQATDDKAQLSTQLADLQKQSAAQAEKLVASEAANKKSQSDYQASQT
FT                   ALSKSSEDVKRLTAQLSESQLAATKVTEEKNKLTAELDKTKKDLASHSIAAVTQSGGEL
FT                   ISDAELKTLQAKESKKTGRSYSVGYLLGQAANSKIEQVVSAGEKIDRNVIVKGFVDRMN
FT                   ELSSMSTEDMRESLNSLDSDIRSRQEKQKTSNVENNQKILDKAGKAKGAVKAKSGFIYQ
FT                   ITKPGSAPKVTMDKGIRLQIIETLGDGKVIASEKDNNVISASVTEIPAVLQEVVLKLGL
FT                   QGEATLYIPPELAYGKDGIPGKIPPNSLSIMNIKILGIKDK"
     MMARVKSFFL ILLLINIQGA HAEEPVDANL GLLDQLQSEN LISAPEPSVF AEKDKTSSPL        60
     IQPPKNIVVP KALVEKPVAQ KPRPKPTPAP VRKAPKALQP ASTQSAPAVP ATANVSDTQK       120
     KANEQLKKSL ETAKSTAEKS RDQYAALQKS YADTQKENQQ LQTQIAALKA KPVVIPPSAD       180
     QKLAQKKTQD ELKKLQNSLK NTQQENQQIT TQLQKLKSSQ KHAESLTEKL SVAQTATKKY       240
     QDEVADIQQS LKKTMGENAR LKAQLTAFKT SQDGSVKKSS EQVAASQLAT KKAQKEFAAL       300
     EASFKKLSSE NTQLKTQLDT VKKQSSARIE QLVSSEHANG KSLAEFAVLN ATLQQATEEN       360
     HKLKTQFETL QKQSTAQADK LQALQSTGNK SQANVVELQT TAKQAAAENV QLKTQLASLQ       420
     KQGASQNEKI AFAVEANNKS LNENQLLQKS LKQATDENAQ LKSQLADLQK QDAVRNDKLS       480
     VSDAVNKKSQ ADYVALQKTL KQATDENAGL KNQLAASQKE TAAQTGKLSV SETAVKKSQA       540
     DYVALQKILK QAADENVQMK TQLADLQKQG TAQNGKLSVY EATIKKSQAD YLVLQKSVKQ       600
     AADENAQMKT QLAELQKQGA AQNEKLSVSQ AANKKSQADY LALQKTLKQA TDDKAQLSTQ       660
     LADLQKQSAA QAEKLVASEA ANKKSQSDYQ ASQTALSKSS EDVKRLTAQL SESQLAATKV       720
     TEEKNKLTAE LDKTKKDLAS HSIAAVTQSG GELISDAELK TLQAKESKKT GRSYSVGYLL       780
     GQAANSKIEQ VVSAGEKIDR NVIVKGFVDR MNELSSMSTE DMRESLNSLD SDIRSRQEKQ       840
     KTSNVENNQK ILDKAGKAKG AVKAKSGFIY QITKPGSAPK VTMDKGIRLQ IIETLGDGKV       900
     IASEKDNNVI SASVTEIPAV LQEVVLKLGL QGEATLYIPP ELAYGKDGIP GKIPPNSLSI       960
     MNIKILGIKD K                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page