(data stored in SCRATCH zone)

EMBL: CP002505.PE176

CP002505.PE176       Location/Qualifiers
FT   CDS             200026..201228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0179"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: ypb:YPTS_4023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71809"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7A0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADW71809.1"
FT                   /translation="MEQVDVVVIGAGAAGMFCAAQAGQGGCRVLLLDNGKKTGRKILMS
FT                   GGGRCNFTNLYAEPAAYLSENPHFCKSALARYTQWDFIDMVNRYGIAWHEKTLGQLFCD
FT                   DSAQQIVTMLDKECEQGNVDVRLRSEISDVQKTENGFVIKVNGSTVSTHSLVIASGGLS
FT                   MPGLGATPFGYRLAEQFGLKVLPTRAGLVPFTLHKPLLDHLQTLSGVSVPAVLTAEDDT
FT                   VFRESILFTHRGMSGPAVLQLSSYWQPGEFVSVNLLPDVDLAAFLNAQRQEHPNQSLKN
FT                   TLAMQLPKRLVECLQTLGQLPDVTLKQLNVPQQAELVEQLQNWQVQPNGTEGYRTAEVT
FT                   LGGVDTKELSSKTMAAAKVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQDLVAVRG
FT                   S"
     MEQVDVVVIG AGAAGMFCAA QAGQGGCRVL LLDNGKKTGR KILMSGGGRC NFTNLYAEPA        60
     AYLSENPHFC KSALARYTQW DFIDMVNRYG IAWHEKTLGQ LFCDDSAQQI VTMLDKECEQ       120
     GNVDVRLRSE ISDVQKTENG FVIKVNGSTV STHSLVIASG GLSMPGLGAT PFGYRLAEQF       180
     GLKVLPTRAG LVPFTLHKPL LDHLQTLSGV SVPAVLTAED DTVFRESILF THRGMSGPAV       240
     LQLSSYWQPG EFVSVNLLPD VDLAAFLNAQ RQEHPNQSLK NTLAMQLPKR LVECLQTLGQ       300
     LPDVTLKQLN VPQQAELVEQ LQNWQVQPNG TEGYRTAEVT LGGVDTKELS SKTMAAAKVP       360
     GLYFIGEVVD VTGWLGGYNF QWAWSSAWAC AQDLVAVRGS                             400
//

If you have problems or comments...

PBIL Back to PBIL home page