(data stored in SCRATCH zone)

EMBL: CP002505.PE180

CP002505.PE180       Location/Qualifiers
FT   CDS             203770..205020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0183"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: eca:ECA0077 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71813"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J1"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADW71813.1"
FT                   /translation="MKRMTGRFTGLSIMLPLLLTSCGTLSEMQVEENPHEVKQLACSQN
FT                   LDDMVDTVAQRYLHREKSSGMAVGIIRNNGAARTWGYGYTNAVNGYKIDGETLFALGSV
FT                   SKGVTGEVVAGLVDKGQLKWDDKLADLLPKNIPLSEDAKNITLLQLATHTSGLPRQKMT
FT                   KDMLESFLRYLYTGDNFYHELDSDAVVDNLSSFKKPLLLVPQYSNLGYALLGYILKLKT
FT                   GEDIQQLSYAFIFNALKMDNTSFYASQLKAYPYRAIGHAGDQPKLIRRGEVVPDWHFSN
FT                   NMVAAASLYSNADDLLKYLRAHIDDSQPGDLSDAIQVTEKVYFQRKIEAANIAWVTDYK
FT                   DGQIITYQVGYIGGYSSYIGFDKKHKNAVVVLQNTFNWSNYIGHDLLLKMAMADDYKAT
FT                   CGKETFFSSPVKEGEAR"
     MKRMTGRFTG LSIMLPLLLT SCGTLSEMQV EENPHEVKQL ACSQNLDDMV DTVAQRYLHR        60
     EKSSGMAVGI IRNNGAARTW GYGYTNAVNG YKIDGETLFA LGSVSKGVTG EVVAGLVDKG       120
     QLKWDDKLAD LLPKNIPLSE DAKNITLLQL ATHTSGLPRQ KMTKDMLESF LRYLYTGDNF       180
     YHELDSDAVV DNLSSFKKPL LLVPQYSNLG YALLGYILKL KTGEDIQQLS YAFIFNALKM       240
     DNTSFYASQL KAYPYRAIGH AGDQPKLIRR GEVVPDWHFS NNMVAAASLY SNADDLLKYL       300
     RAHIDDSQPG DLSDAIQVTE KVYFQRKIEA ANIAWVTDYK DGQIITYQVG YIGGYSSYIG       360
     FDKKHKNAVV VLQNTFNWSN YIGHDLLLKM AMADDYKATC GKETFFSSPV KEGEAR           416
//

If you have problems or comments...

PBIL Back to PBIL home page