(data stored in SCRATCH zone)

EMBL: CP002505.PE22

CP002505.PE22        Location/Qualifiers
FT   CDS             complement(24279..24722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0022"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ypz:YPZ3_3495 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71655"
FT                   /db_xref="GOA:A0A0H3F3D0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3D0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71655.1"
FT                   /translation="MIRAARPADTEAILMLWLRSSLLSHAFIAESYWIESLQMVREDFL
FT                   PKARTWVDCDEDDQVCGFISVMNQQFIGALFVEASHYGDGTAQRLMAAAKEEYPVLLLE
FT                   VYQQNDRAVSFYRKENFEITANTRHPGTDMPTYILRWHHPLSE"
     MIRAARPADT EAILMLWLRS SLLSHAFIAE SYWIESLQMV REDFLPKART WVDCDEDDQV        60
     CGFISVMNQQ FIGALFVEAS HYGDGTAQRL MAAAKEEYPV LLLEVYQQND RAVSFYRKEN       120
     FEITANTRHP GTDMPTYILR WHHPLSE                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page