(data stored in SCRATCH zone)

EMBL: CP002505.PE223

CP002505.PE223       Location/Qualifiers
FT   CDS             complement(256747..257436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0226"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: spe:Spro_4633
FT                   gluconate periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71856"
FT                   /db_xref="GOA:A0A0H3F9P5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9P5"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADW71856.1"
FT                   /translation="MLTIASRCWLCQCPLHLPVQGICSLCMKHLPVAPPCCLRCGLPSS
FT                   GGHADCGRCLLKPPPWDAMIFASPYEMPVSGLVLRFKFSRQPELDTTLARLLFLRWQER
FT                   YRMSNLPRPDVLLSVPLHQKRYFSRGYNQSELLAKPLARWLHCQYLPDALSRNRRTPPQ
FT                   QSLTEHERKWNLRKAFTCHASLRDKHVMLLDDVVTTGSTVREISKILRNQGVASLQIAC
FT                   ICRTLQA"
     MLTIASRCWL CQCPLHLPVQ GICSLCMKHL PVAPPCCLRC GLPSSGGHAD CGRCLLKPPP        60
     WDAMIFASPY EMPVSGLVLR FKFSRQPELD TTLARLLFLR WQERYRMSNL PRPDVLLSVP       120
     LHQKRYFSRG YNQSELLAKP LARWLHCQYL PDALSRNRRT PPQQSLTEHE RKWNLRKAFT       180
     CHASLRDKHV MLLDDVVTTG STVREISKIL RNQGVASLQI ACICRTLQA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page