(data stored in SCRATCH zone)

EMBL: CP002505.PE227

CP002505.PE227       Location/Qualifiers
FT   CDS             260730..261587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0230"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number="2.4.2.52"
FT                   /note="TIGRFAM: triphosphoribosyl-dephospho-CoA synthase
FT                   MdcB; KEGG: kpn:KPN_01562 triphosphoribosyl-dephospho-CoA
FT                   transferase; PFAM: triphosphoribosyl-dephospho-CoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71860"
FT                   /db_xref="GOA:A0A0H3F3Y5"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Y5"
FT                   /inference="protein motif:TFAM:TIGR03132"
FT                   /protein_id="ADW71860.1"
FT                   /translation="MPQTLTTGALLTAEELAERLAETATQALIDEARLSPKPGLVDSRS
FT                   AGAHQDLSLDLMVRSARSLTSTFYLLALHSWQRPADIALRQEVGRLGRAGEAQMMAETG
FT                   GVNTHRGAIWAMGLLVSAVSMQPESLLPLHIAQRAAKIAALPDAFSPKKFSKGSHAVQR
FT                   YQVPGAREEAQSGFPHIIGCALPQLHHSRAHGASESEAQVDALLAVMSTLADTCVLSRG
FT                   GLPALEAMHQGAQAVLEAGGTSTMAGKQRLRHLEHRMLADNTSPGGAADLLAATLFLDR
FT                   VSVV"
     MPQTLTTGAL LTAEELAERL AETATQALID EARLSPKPGL VDSRSAGAHQ DLSLDLMVRS        60
     ARSLTSTFYL LALHSWQRPA DIALRQEVGR LGRAGEAQMM AETGGVNTHR GAIWAMGLLV       120
     SAVSMQPESL LPLHIAQRAA KIAALPDAFS PKKFSKGSHA VQRYQVPGAR EEAQSGFPHI       180
     IGCALPQLHH SRAHGASESE AQVDALLAVM STLADTCVLS RGGLPALEAM HQGAQAVLEA       240
     GGTSTMAGKQ RLRHLEHRML ADNTSPGGAA DLLAATLFLD RVSVV                       285
//

If you have problems or comments...

PBIL Back to PBIL home page