(data stored in SCRATCH zone)

EMBL: CP002505.PE23

CP002505.PE23        Location/Qualifiers
FT   CDS             complement(24719..25291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0023"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; KEGG:
FT                   ypb:YPTS_4132 DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71656"
FT                   /db_xref="GOA:A0A0H3F959"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F959"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ADW71656.1"
FT                   /translation="MATTRCSWVSKEPIYLEYHDKEWGVPIKDGRTLFEMLCLEGQQAG
FT                   LSWITVLRKRENYRQNFHHFDPVRIAKMTDDDVERLVLDAGIIRHRGKIKAIIGNAQAY
FT                   LAMQAGGEDFSEFIWNFVGGQPVINNPLGPEGVPATTAVSDAMSKALKKKGFKFTGSTI
FT                   CYAFMQAAGLVNDHQSYCFCHPANQPS"
     MATTRCSWVS KEPIYLEYHD KEWGVPIKDG RTLFEMLCLE GQQAGLSWIT VLRKRENYRQ        60
     NFHHFDPVRI AKMTDDDVER LVLDAGIIRH RGKIKAIIGN AQAYLAMQAG GEDFSEFIWN       120
     FVGGQPVINN PLGPEGVPAT TAVSDAMSKA LKKKGFKFTG STICYAFMQA AGLVNDHQSY       180
     CFCHPANQPS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page