(data stored in SCRATCH zone)

EMBL: CP002505.PE234

CP002505.PE234       Location/Qualifiers
FT   CDS             266435..266674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cro:ROD_27521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71867"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F509"
FT                   /inference="similar to AA sequence:KEGG:ROD_27521"
FT                   /protein_id="ADW71867.1"
FT                   /translation="MPVILRFKNYRFFFYSNEGNPLEPHHIHVRSGQKEAKLWLSPVAL
FT                   CRQTGSSAKEIREIITLTNVYQTLFQGAWNEYFA"
     MPVILRFKNY RFFFYSNEGN PLEPHHIHVR SGQKEAKLWL SPVALCRQTG SSAKEIREII        60
     TLTNVYQTLF QGAWNEYFA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page