(data stored in SCRATCH zone)

EMBL: CP002505.PE25

CP002505.PE25        Location/Qualifiers
FT   CDS             27568..27816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0025"
FT                   /product="putative stability protein StbD"
FT                   /note="KEGG: sea:SeAg_B1618 putative stability protein
FT                   StbD"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F473"
FT                   /inference="similar to AA sequence:KEGG:SeAg_B1618"
FT                   /protein_id="ADW71658.1"
FT                   /translation="MPFEILTSSAASITELKRDPMGTFSAGEGEAVAILNRNEPAFYCV
FT                   PPDVYAYFLSLAEDVELNRIMDARQGEERIRLTLDDL"
     MPFEILTSSA ASITELKRDP MGTFSAGEGE AVAILNRNEP AFYCVPPDVY AYFLSLAEDV        60
     ELNRIMDARQ GEERIRLTLD DL                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page