(data stored in SCRATCH zone)

EMBL: CP002505.PE250

CP002505.PE250       Location/Qualifiers
FT   CDS             289160..290521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0253"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: yen:YE4005 osmolarity sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71883"
FT                   /db_xref="GOA:A0A0H3F4P9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADW71883.1"
FT                   /translation="MKRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLAVPPAFRREIYRELGISLYTNSAAEESGLRWAQH
FT                   YEFLSQQMAQQLGGPTDVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAIGGAWLFIRIQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMMSDDDSYLAESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEITDLNGILGEVIATESGYEREIDSGLADGELLVNAHPLSIKRA
FT                   VVNMVVNAARYGDGWIKVSSGRELQRAWFQVEDDGPGIEPDQLKHLFQPFVRGESARTT
FT                   SGTGLGLAIVQRIIDAHSGTLDIGKSDRGGLRIRAYLPLPVEMLKAVAVQQKLV"
     MKRIRFSPRS SFARTLLLIV TLLFVSLVTT YLVVLNFAIL PSLQQFNKVL AYEVRMLMTD        60
     RLQLEDGTLL AVPPAFRREI YRELGISLYT NSAAEESGLR WAQHYEFLSQ QMAQQLGGPT       120
     DVRVEVNKNT PVVWLKTWLS PDIWVRVPLT EIHQGDFSPL FRYTLAIMLL AIGGAWLFIR       180
     IQNRPLVELE HAALQVGKGI IPPPLREYGA SEVRSVTRAF NQMAAGVKLL ADDRTLLMAG       240
     VSHDLRTPLT RIRLATEMMS DDDSYLAESI NKDIEECNAI IEQFIDYLRT GQEMPTEITD       300
     LNGILGEVIA TESGYEREID SGLADGELLV NAHPLSIKRA VVNMVVNAAR YGDGWIKVSS       360
     GRELQRAWFQ VEDDGPGIEP DQLKHLFQPF VRGESARTTS GTGLGLAIVQ RIIDAHSGTL       420
     DIGKSDRGGL RIRAYLPLPV EMLKAVAVQQ KLV                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page