(data stored in SCRATCH zone)

EMBL: CP002505.PE275

CP002505.PE275       Location/Qualifiers
FT   CDS             316182..317465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0278"
FT                   /product="Cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="KEGG: spe:Spro_4594 cytosine deaminase; PFAM:
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71908"
FT                   /db_xref="GOA:A0A0H3F4R9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R9"
FT                   /inference="protein motif:PRIAM:3.5.4.1"
FT                   /protein_id="ADW71908.1"
FT                   /translation="MTKTLLRTVKNVRLPDREGLWQIDIEGGVIRQIVPQWDNADYGEH
FT                   ILDAEGGLAIPPFIEPHIHLDTTQTAGQPAWNQSGTLFEGIERWAERKALLSHEDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDPTLTALKAMLEVKAEVAPWVTLQIVAFPQEGIMSY
FT                   PNGEALLEEALKLGADVVGAIPHFEFTREYGVESLHKTFELAKKYDKLIDVHCDEIDDE
FT                   QSRFVETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLEAGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYQQINDGLKLITTYSARTMNLQGYGLESGYAASLVILPAQSGFDAVRRQTPVQYSL
FT                   REGVLIAQTQLAKTLIHLDEDHAVDFNS"
     MTKTLLRTVK NVRLPDREGL WQIDIEGGVI RQIVPQWDNA DYGEHILDAE GGLAIPPFIE        60
     PHIHLDTTQT AGQPAWNQSG TLFEGIERWA ERKALLSHED VKQRAWQTLK WQIANGIQHV       120
     RTHVDVSDPT LTALKAMLEV KAEVAPWVTL QIVAFPQEGI MSYPNGEALL EEALKLGADV       180
     VGAIPHFEFT REYGVESLHK TFELAKKYDK LIDVHCDEID DEQSRFVETV AALALRENMG       240
     ARVTASHTTA MHSYNGAYTS RLFRLLKMSG INFVANPLVN IHLQGRFDTY PKRRGITRVK       300
     EMLEAGINVC FGHDDVFDPW YPLGTANMLQ VLHMGLHVCQ LMGYQQINDG LKLITTYSAR       360
     TMNLQGYGLE SGYAASLVIL PAQSGFDAVR RQTPVQYSLR EGVLIAQTQL AKTLIHLDED       420
     HAVDFNS                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page