(data stored in SCRATCH zone)

EMBL: CP002505.PE278

CP002505.PE278       Location/Qualifiers
FT   CDS             320086..321291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71911"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9Z9"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ADW71911.1"
FT                   /translation="MKKLLVTGIVLGLFSWQATAQTIVLTDAEAGTELGNWKTDNKKLN
FT                   IAGADFSIEQKVLHGGKQEGSKVITITSKGLTIALSPTRGMDLLHVTGDNIRLGWDSPV
FT                   QEVVNPAYINLESRNGVGWLEGFNEMMVRCGFEWTGHPVTADGMIYTLHGRAGNTPASK
FT                   VVVDIADKAPYEITVRGLLKEDTFKKAKLETWTELRYVPGSHSWTIHDTLTNQSDYPHD
FT                   YQIIYHSNFGQPILEQGARFIAPLKSISPFNDYAKKGLADWQTYAGPTKGFDEMVFNMV
FT                   PLADAQGKTIAGVVNKAGNKGASIEFDTHQLPLLTLWKNTDTLKQGYVTGIEPGTNYAY
FT                   PVTIERKQGRVKQLQPGQSTVFELKYSLLPDAQAVKQLEDRVKTLQADHKTDVNETPIA
FT                   VE"
     MKKLLVTGIV LGLFSWQATA QTIVLTDAEA GTELGNWKTD NKKLNIAGAD FSIEQKVLHG        60
     GKQEGSKVIT ITSKGLTIAL SPTRGMDLLH VTGDNIRLGW DSPVQEVVNP AYINLESRNG       120
     VGWLEGFNEM MVRCGFEWTG HPVTADGMIY TLHGRAGNTP ASKVVVDIAD KAPYEITVRG       180
     LLKEDTFKKA KLETWTELRY VPGSHSWTIH DTLTNQSDYP HDYQIIYHSN FGQPILEQGA       240
     RFIAPLKSIS PFNDYAKKGL ADWQTYAGPT KGFDEMVFNM VPLADAQGKT IAGVVNKAGN       300
     KGASIEFDTH QLPLLTLWKN TDTLKQGYVT GIEPGTNYAY PVTIERKQGR VKQLQPGQST       360
     VFELKYSLLP DAQAVKQLED RVKTLQADHK TDVNETPIAV E                           401
//

If you have problems or comments...

PBIL Back to PBIL home page