(data stored in SCRATCH zone)

EMBL: CP002505.PE286

CP002505.PE286       Location/Qualifiers
FT   CDS             complement(328381..329250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0289"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="KEGG: spe:Spro_4578 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71919"
FT                   /db_xref="GOA:A0A0H3F7I9"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7I9"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ADW71919.1"
FT                   /translation="MSAKHPVIAVTGSSGAGTTTTSVAFRKIFQQLGLRAAELEGDSFH
FT                   HFTRPEMDAAIRKARDLGRHISYFGPEANDFGLLEKSFIEYGKTGTGRSRKYLHTYDEA
FT                   VPYNQVPGTFTPWQALPEPTDILFYEGLHGGVVADKIDVAAQVDLLVGVVPIVNLEWIQ
FT                   KLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTIDTSNPFAAKAI
FT                   PSLDESFVVIHFQGLDDIDFPYLLAMLQGSFISHIKTLVVPGGKMGLAMELIMAPLVQR
FT                   LMEGKKIE"
     MSAKHPVIAV TGSSGAGTTT TSVAFRKIFQ QLGLRAAELE GDSFHHFTRP EMDAAIRKAR        60
     DLGRHISYFG PEANDFGLLE KSFIEYGKTG TGRSRKYLHT YDEAVPYNQV PGTFTPWQAL       120
     PEPTDILFYE GLHGGVVADK IDVAAQVDLL VGVVPIVNLE WIQKLVRDTG ERGHSREAVM       180
     DSVVRSMDDY INYITPQFSR THINFQRVPT IDTSNPFAAK AIPSLDESFV VIHFQGLDDI       240
     DFPYLLAMLQ GSFISHIKTL VVPGGKMGLA MELIMAPLVQ RLMEGKKIE                   289
//

If you have problems or comments...

PBIL Back to PBIL home page