(data stored in SCRATCH zone)

EMBL: CP002505.PE290

CP002505.PE290       Location/Qualifiers
FT   CDS             332032..333813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0293"
FT                   /product="glyoxylate carboligase"
FT                   /note="KEGG: eck:EC55989_0522 glyoxylate carboligase;
FT                   TIGRFAM: glyoxylate carboligase; PFAM: thiamine
FT                   pyrophosphate TPP-binding domain-containing protein;
FT                   thiamine pyrophosphate central domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71923"
FT                   /db_xref="GOA:A0A0H3F4T2"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T2"
FT                   /inference="protein motif:TFAM:TIGR01504"
FT                   /protein_id="ADW71923.1"
FT                   /translation="MARMTAAQAAMYVLEKEGITTAFGVPGAAINPFYNAMRLHGKIRH
FT                   VLARHVEGASHMAEGYTRAKAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIQAIAGPVSKMAVTVLEPALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   YDVQTAEIEFDPETYESLPAYKPAATVAQAVKAMEMLNACERPLIVAGGGVINADAAAL
FT                   LQRFAEITQVPVIPTLMGWGVIPDDHRLMAGMVGLQTAHRYGNASLLASDLVFGIGNRF
FT                   ANRHTGSVEKYTAGRKIIHVDIEPTQIGRVLCPDLGIVSDAGEALKLLIEVAEEQRKAG
FT                   KLPCRESWIQECEERKRTMLRKTHFNDVPVKPQRVYEEMSKAFGRNVNYVTTIGLSQIA
FT                   AAQMLHVFEPRHWINCGQAGPLGWTIPAALGVCIAAPERQVVGISGDYDFQFMIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSEDVKGYGVDHVKVVEG
FT                   LGCKAIRVFKPEDIAPAFTEAKRLMKKHQVPVVVEIMLERVTNISMGGEIDSVNEFEPV
FT                   ADNADDAPTHVSFMKYE"
     MARMTAAQAA MYVLEKEGIT TAFGVPGAAI NPFYNAMRLH GKIRHVLARH VEGASHMAEG        60
     YTRAKAGNIG VCLGTSGPAG TDMITALYSA SADSIPILCI TGQAPRARLH KEDFQAVDIQ       120
     AIAGPVSKMA VTVLEPALVP RVLQQAFHLM RSGRPGPVLV DLPYDVQTAE IEFDPETYES       180
     LPAYKPAATV AQAVKAMEML NACERPLIVA GGGVINADAA ALLQRFAEIT QVPVIPTLMG       240
     WGVIPDDHRL MAGMVGLQTA HRYGNASLLA SDLVFGIGNR FANRHTGSVE KYTAGRKIIH       300
     VDIEPTQIGR VLCPDLGIVS DAGEALKLLI EVAEEQRKAG KLPCRESWIQ ECEERKRTML       360
     RKTHFNDVPV KPQRVYEEMS KAFGRNVNYV TTIGLSQIAA AQMLHVFEPR HWINCGQAGP       420
     LGWTIPAALG VCIAAPERQV VGISGDYDFQ FMIEELAVGA QFNIPYIHVL VNNAYLGLIR       480
     QSQRAFDMDY CVQLAFENIN SEDVKGYGVD HVKVVEGLGC KAIRVFKPED IAPAFTEAKR       540
     LMKKHQVPVV VEIMLERVTN ISMGGEIDSV NEFEPVADNA DDAPTHVSFM KYE              593
//

If you have problems or comments...

PBIL Back to PBIL home page