(data stored in SCRATCH zone)

EMBL: CP002505.PE3

CP002505.PE3         Location/Qualifiers
FT   CDS             2679..3767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: spe:Spro_0034 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71636"
FT                   /db_xref="GOA:A0A0H3F937"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F937"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADW71636.1"
FT                   /translation="MALTRLLIKDFRNIEAADLDPSPGFNFLVGPNGSGKTSVLEAVYT
FT                   LGHGRAFRSLQAGRVIRHDQPEFVLHARVDDGGDRELSIGLSKSRQGDSKVRIDGSDGH
FT                   KVSELAQMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHHDPGFFIAWSNLRRLLKQRN
FT                   AALRQVSRYAQIRAWDQELIPLAGRISEWRAAYSDAIAADISATCAQFLPEFALSFSFQ
FT                   RGWDKETEYGELLERNFERDRALTYTASGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEFLTRQSGRRCLYLLDDFASELDADRRRLLADRLKATQAQVFVSAISAEQVTD
FT                   MMGEKGKMFRVEQGKIAVLSQD"
     MALTRLLIKD FRNIEAADLD PSPGFNFLVG PNGSGKTSVL EAVYTLGHGR AFRSLQAGRV        60
     IRHDQPEFVL HARVDDGGDR ELSIGLSKSR QGDSKVRIDG SDGHKVSELA QMLPMQLITP       120
     EGFTLLNGGP KYRRAFIDWG CFHHDPGFFI AWSNLRRLLK QRNAALRQVS RYAQIRAWDQ       180
     ELIPLAGRIS EWRAAYSDAI AADISATCAQ FLPEFALSFS FQRGWDKETE YGELLERNFE       240
     RDRALTYTAS GPHKADFRIR ADGTPVEDLL SRGQLKLLMC ALRLAQGEFL TRQSGRRCLY       300
     LLDDFASELD ADRRRLLADR LKATQAQVFV SAISAEQVTD MMGEKGKMFR VEQGKIAVLS       360
     QD                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page