(data stored in SCRATCH zone)

EMBL: CP002505.PE303

CP002505.PE303       Location/Qualifiers
FT   CDS             348286..349185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0306"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: eum:ECUMN_0561
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71936"
FT                   /db_xref="GOA:A0A0H3FA51"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA51"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADW71936.1"
FT                   /translation="METLVVALGGNALLQRGECLSAENQYRNIATVAGALARLATRYRL
FT                   AIVHGNGPQVGLLSLQNQAYTEVPAYPLDILVAETQGMIGFMLAQMLGQQTGMPEVSTV
FT                   LTRIEVDSRDPAFASPEKFIGPVYPPGSQQELENLHGWKMKADGAYLRRVVASPVPKRI
FT                   VDIDAIQQLLARGHVVICNGGGGIPVFEDGNGAQAVIDKDLSAALLARQLKAQKLVILT
FT                   DADAVYEHWGTPQQRAIRRATPAQLAPFAQNDGSMGPKVAAVSAFVNYSGYPAYIGALD
FT                   QIEAVLAGDAGTCISATA"
     METLVVALGG NALLQRGECL SAENQYRNIA TVAGALARLA TRYRLAIVHG NGPQVGLLSL        60
     QNQAYTEVPA YPLDILVAET QGMIGFMLAQ MLGQQTGMPE VSTVLTRIEV DSRDPAFASP       120
     EKFIGPVYPP GSQQELENLH GWKMKADGAY LRRVVASPVP KRIVDIDAIQ QLLARGHVVI       180
     CNGGGGIPVF EDGNGAQAVI DKDLSAALLA RQLKAQKLVI LTDADAVYEH WGTPQQRAIR       240
     RATPAQLAPF AQNDGSMGPK VAAVSAFVNY SGYPAYIGAL DQIEAVLAGD AGTCISATA        299
//

If you have problems or comments...

PBIL Back to PBIL home page